PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G043900.1
Common NamePOPTR_0008s04350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 222aa    MW: 24036.6 Da    PI: 7.6081
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G043900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.5e-43681671100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i++lq+q++ l+
  Potri.008G043900.1  68 PCAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAISQLQKQVSDLQ 158
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Potri.008G043900.1 159 AQLAKAQAE 167
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.94567168IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-4368165IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MDMLQKPAAI SPVKAPSQFS CSPSSSSSPP SCHHSCPSTF HSPSKSNSPG LTSPSAATLP  60
PPPVVITPCA ACKILRRRCV DKCVLAPYFP PSEPYKFTIA HRVFGASNII KFLQELPESQ  120
RADAVSSMVY EASARIRDPV YGCAGAISQL QKQVSDLQAQ LAKAQAEVVN MQCQQANLVA  180
LLCMEMKQSQ QEPILQQHQY IDTSCFLDEN NLGASWEPLW T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002312035.21e-162hypothetical protein POPTR_0008s04350g
SwissprotQ9LQR02e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HLY21e-161B9HLY2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04350.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-73LOB domain-containing protein 1